PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400019959
Common NameLOC102583544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 698aa    MW: 75773.8 Da    PI: 4.8709
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400019959genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY72.55.7e-23290348160
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           ++DgynW KYG  + kgse+prs+Y+Ct+++C vkk+  r +  ++v+ei+Y+g Hnh+k
  PGSC0003DMP400019959 290 VEDGYNWIKYGENQAKGSEYPRSFYKCTHPNCLVKKERARYH-KGHVTEIIYNGAHNHPK 348
                           58**********************************988888.9**************85 PP

2WRKY101.45.4e-32502560159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+  d++ v++tY g+Hnh+
  PGSC0003DMP400019959 502 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCNVRKHVERAPLDQRSVITTYDGKHNHD 560
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-19284349IPR003657WRKY domain
PROSITE profilePS5081117.901285349IPR003657WRKY domain
SuperFamilySSF1182905.89E-19289349IPR003657WRKY domain
SMARTSM007741.2E-21290348IPR003657WRKY domain
PfamPF031069.9E-18291347IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-35487562IPR003657WRKY domain
SuperFamilySSF1182907.98E-28494562IPR003657WRKY domain
PROSITE profilePS5081136.919497562IPR003657WRKY domain
SMARTSM007742.0E-37502561IPR003657WRKY domain
PfamPF031061.8E-24503560IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MAGFNDHVAS GHWIPPSPSP SPSSRALISS LLADDFGWSA HLEETNESRN LVVKPQEHVT  60
WCNSDGAQTG AMTDQTVNVS APSEQNTSSR GGLMERMVAR TGFNVPRLNT DGLRPPFVSQ  120
NQEVKSPYLS IAAGLSPSIL LYSPVLLYNP LVYPSPTTGL LPCASGNESR SVMLTTEAAD  180
KRNETALGTN SSSSLSFNPI METGGVNEFS QIEGSVHPNN SLQLHSMEAT QNEQICHETT  240
DFPMFTEEDV RGSDKNPEIR TFNAVGGSTE HSPSLEEQQD EDSTDGDSSV EDGYNWIKYG  300
ENQAKGSEYP RSFYKCTHPN CLVKKERARY HKGHVTEIIY NGAHNHPKPL PNQISTLGSS  360
SSFGDMQLDN VDPTGTGVNS ELALEIIQQG PTAGGLEWKN DNLEATSLAD LHSEYCRGAA  420
TLHSNDAPLG SADAVDISSA FTTDGDDHGT RGSASLDCED GGDESESKIR KIEPDATDTR  480
SVSRSIRQPR IVVQTISEVD VLDDGYRWRK YGQKVVKGNP NPRSYYKCTN PGCNVRKHVE  540
RAPLDQRSVI TTYDGKHNHD VPAERSSSQV ISGASNSRSN PITTNAQDQV GRPEPKQLQK  600
TSKRYGRAPS FGPTSGSNSF ETNQQQGLTD LSMTGFNSDQ HQFSVPSHPY TGWLQPVNDA  660
GFVLPEGEPM PDPNMNYSNA SSTYQQTMNG LPPGPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36493563878Probable WRKY transcription factor 4
2lex_A3e-36493563878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352570.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLM1ASL70.0M1ASL7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000293280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-114WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]